glp-1 peptide sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 - Glp 1agonists GLP-1 (7-36) amide Unraveling the GLP-1 Peptide Sequence: A Deep Dive into its Structure and Function

Glp 1是 什么 The glp-1 peptide sequence is central to understanding the function of glucagon-like peptide-1, a crucial hormone with significant implications for metabolic health. This peptide plays a vital role in glucose regulation and has become a focal point for therapeutic development, particularly in managing conditions like type 2 diabetes and obesity作者：C Orskov·1989·被引用次数：314—To determine theamino acid sequenceof the naturally occurring peptide we isolated GLP-1 from human small intestine by hydrophobic, gel permeation, and .... Delving into the intricacies of the amino acid sequence of GLP-1 provides essential insights into its biological activity and therapeutic potential.GLP-1 Protein Human | Glucagon Like Peptide-1

The Core GLP-1 Peptide Sequence and its Variations

The primary biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36) amide. The full amino acid sequence of human GLP-1 (1-37), as documented in scientific literature, is HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG. However, the most commonly studied and therapeutically relevant forms often begin at amino acid position 7.

For instance, the GLP-1 (7-37) sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG作者：B Manandhar·2015·被引用次数：236—(102) It has the sequence ofexendin-4and similarly showed a long circulation half-life (approximately 8 days) as 11. Another long acting GLP- .... Another significant bioactive form is GLP-1 (7-36) amide, represented by the sequence (1-letter):HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2Glucagon-like Peptide-1 (GLP-1) Analogs - ACS Publications. This specific form, often simply referred to as GLP-1(7-36)amide, is identical in humans, rats, and mice.Active GLP-1 protein secondary structure includestwo α-helices from amino acid position 13–20 and 24–35separated by a linker region. diagram GLP-1 and ...

Researchers have also identified and sequenced complete sequences of glucagon-like peptide-1 from various species, including human and pig small intestineGlucagon-Like Peptide 1, GLP-1 (7-36), amide, human .... Early work in 1988 by C. Orskov et al. was instrumental in isolating and partly sequencing pig GLP-1, revealing that the N-terminal amino acid residue corresponds to proglucagon His7'.GLP-1 peptide sequence

The GLP-1 peptide sequence for human GLP-1 (aa 7-36), as provided and purified with a purity of >96% by RP-HPLC, is H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg. This detailed sequence is crucial for understanding its interactions with its receptor作者：C Orskov·1989·被引用次数：314—To determine theamino acid sequenceof the naturally occurring peptide we isolated GLP-1 from human small intestine by hydrophobic, gel permeation, and ....

Structural Features of GLP-1

The GLP-1 peptide is known to possess specific structural elements that contribute to its function. Active GLP-1 protein exhibits secondary structure, including two α-helices from amino acid position 13–20 and 24–35, separated by a linker region. These structural motifs are vital for the peptide's stability and its ability to bind to the Glucagon-like peptide 1 receptor (GLP-1R).

Modifications to the glp-1 peptide sequence have been explored to enhance its therapeutic properties. For example, the insertion of 6-aminohexanoic acid between histidine and alanine at positions 7 and 8 of glucagon-like peptide 1 (GLP-1) has been shown to prevent N-terminal degradation by enzymes. This highlights the importance of understanding the precise amino acid sequence for designing effective GLP-1 analogs.

GLP-1 Receptor Interactions and Analogs

The GLP-1 receptor (GLP-1R) is a G protein-coupled receptor that mediates the effects of GLP-1. The interaction between the GLP-1 peptide and its receptor is a key area of research. Studies have even revealed the crystal structure of the GLP-1 receptor extracellular domain in complex with antagonists like exendin-4. Furthermore, the crystal structure of Semaglutide peptide backbone in complex with the GLP-1 receptor extracellular domain provides valuable insights into the binding mechanisms of GLP-1 receptor agonists.

The development of GLP-1 agonists has revolutionized the treatment of type 2 diabetes and obesityGlucagon-likepeptide 1. Potent stimulator of glucose-dependent insulin release (PubMed:22037645, PubMed:40446798). Also stimulates insulin release in response .... These agonists are synthetic protein preparations that have partial or complete amino acid sequence homology with GLP-1 found in the body. While they mimic the action of endogenous GLP-1, many are engineered for longer half-lives and improved efficacy. Semaglutide is a prominent example of such an analog, with its structure and binding to the GLP-1 receptor being extensively studied.

The Broader Context of GLP-1

GLP-1 is an incretin hormone produced by intestinal L cells through the processing of proglucagonThe insertion of 6-aminohexanoic acid between histidine and alanine at positions 7 and 8 of glucagon-likepeptide1 (GLP-1) prevents N-terminal degradation by .... Its secretion is stimulated by nutrient intake in the gut.Human Glucagon-like Peptide 1 / GLP-1 (aa 7-36) GLP-1 plays a critical role in glucose homeostasis by stimulating glucose-dependent insulin release from pancreatic beta cells and suppressing glucagon secretionGLP-1 Protein Human | Glucagon Like Peptide-1. This dual action helps to lower blood glucose levels.

The discovery and characterization of the glp-1 peptide sequence and its receptor have opened new avenues for understanding and treating metabolic disorders. Research continues to explore the full spectrum of GLP-1's actions, including its potential effects on cardiovascular health and neuroprotection. The peptide's journey from a newly identified hormone to a cornerstone of modern pharmacotherapy underscores the power of understanding fundamental biological sequencesComplete Sequences of Glucagon-like Peptide-1 from .... The quest for novel GLP-1-based therapies continues, driven by the profound impact this peptide has on human health.